Lineage for d1a6fa_ (1a6f A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716784Family d.14.1.2: RNase P protein [54220] (1 protein)
  6. 716785Protein RNase P protein [54221] (3 species)
  7. 716786Species Bacillus subtilis [TaxId:1423] [54222] (1 PDB entry)
  8. 716787Domain d1a6fa_: 1a6f A: [37564]
    complexed with so4, zn; mutant

Details for d1a6fa_

PDB Entry: 1a6f (more details), 2.6 Å

PDB Description: rnase p protein from bacillus subtilis
PDB Compounds: (A:) ribonuclease p protein

SCOP Domain Sequences for d1a6fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6fa_ d.14.1.2 (A:) RNase P protein {Bacillus subtilis [TaxId: 1423]}
ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn
rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk

SCOP Domain Coordinates for d1a6fa_:

Click to download the PDB-style file with coordinates for d1a6fa_.
(The format of our PDB-style files is described here.)

Timeline for d1a6fa_: