Lineage for d1a6f__ (1a6f -)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253872Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 253873Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 253921Family d.14.1.2: RNase P protein [54220] (1 protein)
  6. 253922Protein RNase P protein [54221] (2 species)
  7. 253923Species Bacillus subtilis [TaxId:1423] [54222] (1 PDB entry)
  8. 253924Domain d1a6f__: 1a6f - [37564]
    complexed with so4, zn; mutant

Details for d1a6f__

PDB Entry: 1a6f (more details), 2.6 Å

PDB Description: rnase p protein from bacillus subtilis

SCOP Domain Sequences for d1a6f__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6f__ d.14.1.2 (-) RNase P protein {Bacillus subtilis}
ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn
rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk

SCOP Domain Coordinates for d1a6f__:

Click to download the PDB-style file with coordinates for d1a6f__.
(The format of our PDB-style files is described here.)

Timeline for d1a6f__: