Lineage for d1a6f__ (1a6f -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) 
Family d.14.1.2: RNase P protein [54220] (1 protein) Protein RNase P protein [54221] (2 species) Species Bacillus subtilis [TaxId:1423] [54222] (1 PDB entry) 
Domain d1a6f__: 1a6f - [37564]
Details for d1a6f__
PDB Entry: 1a6f (more details), 2.6 Å
PDB Description: rnase p protein from bacillus subtilis
SCOP Domain Sequences for d1a6f__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6f__ d.14.1.2 (-) RNase P protein {Bacillus subtilis}
ahlkkrnrlkknedfqkvfkhgtsvanrqfvlytldqpendelrvglsvskkignavmrn
rikrlirqafleekerlkekdyiiiarkpasqltyeetkkslqhlfrksslyk
SCOP Domain Coordinates for d1a6f__:
Click to download the PDB-style file with coordinates for d1a6f__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a6f__:
- d1a6f__ appears in SCOP 1.57
- d1a6f__ appears in the current release, SCOPe 2.08, called d1a6fa_
View in 3D