SCOPe 2.06: Domain d1hnxi_: 1hnx I:

Lineage for d1hnxi_ (1hnx I:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S9 [54218] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
   Uniprot P80374

8. Domain d1hnxi_: 1hnx I: [37563]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
   complexed with mg, pcy, zn

Details for d1hnxi_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1hnxi_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d1hnxi_:

• d1hnxi_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxi_ appears in SCOPe 2.05
  
• d1hnxi_ appears in SCOPe 2.07
  
• d1hnxi_ appears in the current release, SCOPe 2.08