SCOPe 2.08: Domain d6jh1d1: 6jh1 D:3-78

Lineage for d6jh1d1 (6jh1 D:3-78)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [375619] (1 PDB entry)

8. Domain d6jh1d1: 6jh1 D:3-78 [375627]
   Other proteins in same PDB: d6jh1a_, d6jh1b_
   automated match to d3pseb1

Details for d6jh1d1

PDB Entry: 6jh1, 3 Å

PDB Description: crystal structure of bisg15/ns1b complex

PDB Compounds: (D:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6jh1d1:

Sequence; same for both SEQRES and ATOM records:

>d6jh1d1 d.15.1.0 (D:3-78) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gdltvkmlggqeilvplrdsmtvselkqfiaqkinvpafqqrlahldsrevlqegvplvl
qglragstvllvvqns

Timeline for d6jh1d1:

• d6jh1d1 first appeared in SCOPe 2.07