SCOP 1.67: Domain d1hnwi_: 1hnw I:

Lineage for d1hnwi_ (1hnw I:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S9 [54218] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (14 PDB entries)

8. Domain d1hnwi_: 1hnw I: [37562]
   Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
   complexed with mg, tac, zn

Details for d1hnwi_

PDB Entry: 1hnw, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwi_:

Sequence; same for both SEQRES and ATOM records:

>d1hnwi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d1hnwi_:

• d1hnwi_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnwi_ appears in SCOP 1.65
  
• d1hnwi_ appears in SCOP 1.69
  
• d1hnwi_ appears in the current release, SCOPe 2.08