Lineage for d1hnwi_ (1hnw I:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189110Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 189111Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 189112Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 189134Protein Ribosomal protein S9 [54218] (1 species)
  7. 189135Species Thermus thermophilus [TaxId:274] [54219] (10 PDB entries)
  8. 189140Domain d1hnwi_: 1hnw I: [37562]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwi_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (I:)

SCOP Domain Sequences for d1hnwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1hnwi_:

Click to download the PDB-style file with coordinates for d1hnwi_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwi_: