Class a: All alpha proteins [46456] (290 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species) |
Species Influenza b virus (strain b/lee/1940) [TaxId:518987] [375439] (3 PDB entries) |
Domain d6jh1a_: 6jh1 A: [375615] Other proteins in same PDB: d6jh1c1, d6jh1c2, d6jh1d1, d6jh1d2 automated match to d3sdlb_ |
PDB Entry: 6jh1 (more details), 3 Å
SCOPe Domain Sequences for d6jh1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jh1a_ a.16.1.1 (A:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza b virus (strain b/lee/1940) [TaxId: 518987]} qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe nkrmsleerkaigvkmmkvllfmdpsagiegf
Timeline for d6jh1a_: