Lineage for d1hnzi_ (1hnz I:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716673Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 716753Protein Ribosomal protein S9 [54218] (1 species)
  7. 716754Species Thermus thermophilus [TaxId:274] [54219] (29 PDB entries)
  8. 716759Domain d1hnzi_: 1hnz I: [37561]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzi_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (I:) 30S ribosomal protein S9

SCOP Domain Sequences for d1hnzi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1hnzi_:

Click to download the PDB-style file with coordinates for d1hnzi_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzi_: