![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (3 proteins) |
![]() | Protein Ribosomal protein S9 [54218] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54219] (10 PDB entries) |
![]() | Domain d1hnzi_: 1hnz I: [37561] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1hnzi_: