SCOPe 2.07: Domain d6k12c1: 6k12 C:21-160

Lineage for d6k12c1 (6k12 C:21-160)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Babesia microti [TaxId:1133968] [375569] (3 PDB entries)

8. Domain d6k12c1: 6k12 C:21-160 [375606]
   Other proteins in same PDB: d6k12a2, d6k12b2, d6k12c2, d6k12d2, d6k12f2
   automated match to d4jnka1

Details for d6k12c1

PDB Entry: 6k12, 2.79 Å

PDB Description: babesia microti lactate dehydrogenase apo form (bmldh)

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6k12c1:

Sequence, based on SEQRES records:

>d6k12c1 c.2.1.0 (C:21-160) automated matches {Babesia microti [TaxId: 1133968]}
nkitvigvgavgmacafsilnkeladelvlidvvedklkgemmdlqqgslflktpniiag
kdyeltansklvvvtagarqqegesrlnlvqrnvnifkfiipnvvkyspdcillivsnpv
diltyvawklsgfplnrvig

Sequence, based on observed residues (ATOM records):

>d6k12c1 c.2.1.0 (C:21-160) automated matches {Babesia microti [TaxId: 1133968]}
nkitvigvgavgmacafsilnkeladelvlivvedklkgemmdlqqgslflktiiagkdy
eltansklvvvtagvqrnvnifkfiipnvvkyspdcillivsnpvdiltyvawklsgfpl
nrvig

Timeline for d6k12c1:

• d6k12c1 is new in SCOPe 2.07-stable
  
• d6k12c1 appears in the current release, SCOPe 2.08