SCOP 1.59: Domain d1hr0i_: 1hr0 I:

Lineage for d1hr0i_ (1hr0 I:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.1: Translational machinery components [54212] (3 proteins)

6. Protein Ribosomal protein S9 [54218] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (10 PDB entries)

8. Domain d1hr0i_: 1hr0 I: [37560]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0i_

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0i_:

Sequence; same for both SEQRES and ATOM records:

>d1hr0i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d1hr0i_:

• d1hr0i_ first appeared (with stable ids) in SCOP 1.55
  
• d1hr0i_ appears in SCOP 1.57
  
• d1hr0i_ appears in SCOP 1.61
  
• d1hr0i_ appears in the current release, SCOPe 2.08