Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Babesia microti [TaxId:1133968] [375569] (3 PDB entries) |
Domain d6k13b1: 6k13 B:1-160 [375596] Other proteins in same PDB: d6k13a2, d6k13b2, d6k13b3 automated match to d4jnka1 complexed with nad, oxm |
PDB Entry: 6k13 (more details), 1.89 Å
SCOPe Domain Sequences for d6k13b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k13b1 c.2.1.0 (B:1-160) automated matches {Babesia microti [TaxId: 1133968]} mhslkeeflirltnedlnasnkitvigvgavgmacafsilnkeladelvlidvvedklkg emmdlqqgslflktpniiagkdyeltansklvvvtagarqqegesrlnlvqrnvnifkfi ipnvvkyspdcillivsnpvdiltyvawklsgfplnrvig
Timeline for d6k13b1: