Lineage for d6k61d_ (6k61 d:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611471Species Nostoc sp. [TaxId:103690] [375588] (1 PDB entry)
  8. 2611472Domain d6k61d_: 6k61 d: [375589]
    Other proteins in same PDB: d6k61a_, d6k61b_, d6k61c_, d6k61e_, d6k61f_, d6k61j_, d6k61l_, d6k61m_
    automated match to d1jb0d_
    complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

Details for d6k61d_

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120
PDB Compounds: (d:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d6k61d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61d_ d.187.1.1 (d:) automated matches {Nostoc sp. [TaxId: 103690]}
tlsgktplfagstgglltkaveeekyaitwtspkaqvfelptggaatmhegenllyiark
eygialggqlrkfkitnykiyrilpsgettfihpadgvfpekvnagrekvrfnarsigen
pnpsqvkfsgkatyda

SCOPe Domain Coordinates for d6k61d_:

Click to download the PDB-style file with coordinates for d6k61d_.
(The format of our PDB-style files is described here.)

Timeline for d6k61d_: