Lineage for d6k61e_ (6k61 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393377Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2393393Protein automated matches [347347] (3 species)
    not a true protein
  7. 2393394Species Nostoc sp. [TaxId:103690] [375573] (1 PDB entry)
  8. 2393395Domain d6k61e_: 6k61 E: [375574]
    Other proteins in same PDB: d6k61a_, d6k61b_, d6k61c_, d6k61d_, d6k61f_, d6k61j_, d6k61l_, d6k61m_
    automated match to d1qp2a_
    complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

Details for d6k61e_

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120
PDB Compounds: (E:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d6k61e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61e_ b.34.4.2 (E:) automated matches {Nostoc sp. [TaxId: 103690]}
vqrgskvrilrpesywfqdvgtvasvdqsgikypvivrfdkvnyagintnnfavdeliev
e

SCOPe Domain Coordinates for d6k61e_:

Click to download the PDB-style file with coordinates for d6k61e_.
(The format of our PDB-style files is described here.)

Timeline for d6k61e_: