| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Ribosomal protein S5, C-terminal domain [54215] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54217] (14 PDB entries) |
| Domain d1hnwe1: 1hnw E:74-154 [37556] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ complexed with mg, tac, zn |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg
Timeline for d1hnwe1: