Lineage for d6k61b_ (6k61 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633160Species Nostoc sp. [TaxId:103690] [375529] (1 PDB entry)
  8. 2633162Domain d6k61b_: 6k61 B: [375557]
    Other proteins in same PDB: d6k61c_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61l_, d6k61m_
    automated match to d5l8rb_
    complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

Details for d6k61b_

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120
PDB Compounds: (B:) Photosystem I P700 chlorophyll a apoprotein A2 1

SCOPe Domain Sequences for d6k61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61b_ f.29.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
atkfpkfsqdlaqdpttrriwyamamgndfeshdgmteenlyqkifathfghlaiiflwa
ssllfhvawqgnfeqwikdplhvrpiahaiwdphfgkpaieaftqagangpvniaysgvy
hwwytigmrtntelytgsvflllfaslflfagwlhlqpkfrpslawfksaesrlnhhlag
lfgvsslawaghlihvaipesrgqhvgwdnflstaphpaglqpfftgnwgvyaqnpdtag
hifstsqgagtailtflggfhpqteslwltdmahhhlaiavlfivaghmyrtnfgighsi
kemmnaktffgkpvegpfnmphqgiydtynnslhfqlgwhlaclgvvtswvaqhmyslps
yafiakdyttqaalythhqyiaiflmvgafahgaiflvrdydpeqnkgnvlervlqhkea
iishlswvslflgfhtlglyvhndvvvafgtpekqiliepvfaqfiqaahgkvlygldtl
lsnpdsvaytaypnyanvwlpgwldainsgtnslfltigpgdflvhhaialglhtttlil
vkgaldargsklmpdkkdfgyafpcdgpgrggtcdisawdsfylslfwalntvgwvtfyw
hwkhlgiwqgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfgh
lvwatgfmfliswrgywqelietlvwahertpianlvrwkdkpvalsivqarvvglahft
vgyvltyaafliastagkfg

SCOPe Domain Coordinates for d6k61b_:

Click to download the PDB-style file with coordinates for d6k61b_.
(The format of our PDB-style files is described here.)

Timeline for d6k61b_: