SCOPe 2.07: Domain d6k09d2: 6k09 D:128-215

Lineage for d6k09d2 (6k09 D:128-215)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.0: automated matches [238448] (1 protein)
   not a true family

6. Protein automated matches [238450] (4 species)
   not a true protein

7. Species Caenorhabditis elegans [TaxId:6239] [375480] (4 PDB entries)

8. Domain d6k09d2: 6k09 D:128-215 [375555]
   Other proteins in same PDB: d6k09a1, d6k09a2, d6k09b1, d6k09b2
   automated match to d2jssa1

Details for d6k09d2

PDB Entry: 6k09, 2.25 Å

PDB Description: crystal structure b of cenap1-h2a-h2b complex

PDB Compounds: (D:) Histone H2B 1,Histone H2A

SCOPe Domain Sequences for d6k09d2:

Sequence; same for both SEQRES and ATOM records:

>d6k09d2 a.22.1.0 (D:128-215) automated matches {Caenorhabditis elegans [TaxId: 6239]}
kaksrssraglqfpvgrlhrilrkgnyaqrvgagapvylaavleylaaevlelagnaard
nkktriaprhlqlavrndeelnkllagv

Timeline for d6k09d2:

• d6k09d2 is new in SCOPe 2.07-stable
  
• d6k09d2 appears in the current release, SCOPe 2.08