Lineage for d6k09d1 (6k09 D:30-122)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699233Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 2699234Protein automated matches [238450] (4 species)
    not a true protein
  7. 2699259Species Nematode (Caenorhabditis elegans) [TaxId:6239] [375480] (4 PDB entries)
  8. 2699262Domain d6k09d1: 6k09 D:30-122 [375554]
    Other proteins in same PDB: d6k09a1, d6k09a2, d6k09b1, d6k09b2
    automated match to d2jssa2

Details for d6k09d1

PDB Entry: 6k09 (more details), 2.25 Å

PDB Description: crystal structure b of cenap1-h2a-h2b complex
PDB Compounds: (D:) Histone H2B 1,Histone H2A

SCOPe Domain Sequences for d6k09d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k09d1 a.22.1.0 (D:30-122) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
rkesysvyiyrvlkqvhpdtgvsskamsimnsfvndvferiaaeasrlahynkrstissr
eiqtavrlilpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d6k09d1:

Click to download the PDB-style file with coordinates for d6k09d1.
(The format of our PDB-style files is described here.)

Timeline for d6k09d1:

2699262
d6k09d1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6k09d2