Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) |
Family d.14.1.1: Translational machinery components [54212] (3 proteins) |
Protein Ribosomal protein S5, C-terminal domain [54215] (2 species) |
Species Thermus thermophilus [TaxId:274] [54217] (10 PDB entries) |
Domain d1hnze1: 1hnz E:74-154 [37555] Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnze1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d1hnze1: