Lineage for d1hr0e1 (1hr0 E:74-154)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598221Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 598237Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 598240Species Thermus thermophilus [TaxId:274] [54217] (18 PDB entries)
  8. 598244Domain d1hr0e1: 1hr0 E:74-154 [37554]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0e1

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1hr0e1:

Click to download the PDB-style file with coordinates for d1hr0e1.
(The format of our PDB-style files is described here.)

Timeline for d1hr0e1: