Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) |
Family d.14.1.1: Translational machinery components [54212] (3 proteins) |
Protein Ribosomal protein S5, C-terminal domain [54215] (2 species) |
Species Thermus thermophilus [TaxId:274] [54217] (10 PDB entries) |
Domain d1hr0e1: 1hr0 E:74-154 [37554] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOP Domain Sequences for d1hr0e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d1hr0e1: