Lineage for d6k61f_ (6k61 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631477Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 2631481Protein automated matches [236583] (4 species)
    not a true protein
  7. 2631482Species Nostoc sp. [TaxId:103690] [375538] (1 PDB entry)
  8. 2631483Domain d6k61f_: 6k61 F: [375539]
    Other proteins in same PDB: d6k61a_, d6k61b_, d6k61c_, d6k61d_, d6k61e_, d6k61j_, d6k61l_, d6k61m_
    automated match to d1jb0f_
    complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

Details for d6k61f_

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120
PDB Compounds: (F:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6k61f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61f_ f.23.16.1 (F:) automated matches {Nostoc sp. [TaxId: 103690]}
lgadltpcaenpafqalaknarnttadpqsgqkrferysqalcgpegyphlivdgrldra
gdflipsilflyiagwigwvgraylqaikkdsdteqkeiqldlgialpiiatgfawpaaa
vkellsgeltakdseitvspr

SCOPe Domain Coordinates for d6k61f_:

Click to download the PDB-style file with coordinates for d6k61f_.
(The format of our PDB-style files is described here.)

Timeline for d6k61f_: