SCOP 1.67: Domain d1fjge1: 1fjg E:74-154

Lineage for d1fjge1 (1fjg E:74-154)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (14 PDB entries)

8. Domain d1fjge1: 1fjg E:74-154 [37553]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
   complexed with mg, par, scm, sry, zn

Details for d1fjge1

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjge1:

Sequence; same for both SEQRES and ATOM records:

>d1fjge1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d1fjge1:

• d1fjge1 first appeared (with stable ids) in SCOP 1.55
  
• d1fjge1 appears in SCOP 1.65
  
• d1fjge1 appears in SCOP 1.69
  
• d1fjge1 appears in the current release, SCOPe 2.08