Lineage for d6k61l_ (6k61 L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633219Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 2633220Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 2633240Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 2633241Protein automated matches [375526] (1 species)
    not a true protein
  7. 2633242Species Nostoc sp. [TaxId:103690] [375527] (1 PDB entry)
  8. 2633243Domain d6k61l_: 6k61 L: [375528]
    Other proteins in same PDB: d6k61a_, d6k61b_, d6k61c_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61m_
    automated match to d1jb0l_
    complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

Details for d6k61l_

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120
PDB Compounds: (L:) Photosystem I reaction center subunit XI

SCOPe Domain Sequences for d6k61l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61l_ f.31.1.0 (L:) automated matches {Nostoc sp. [TaxId: 103690]}
nrevvfpagrdpqwgnletpvnasplvkwfinnlpayrpgltpfrrglevgmahgyflfg
pfaklgplrdaananlagllgaiglvvlftlalslyansnpptalasvtvpnppdafqsk
egwnnfasafliggiggavvayfltsnlaliqglv

SCOPe Domain Coordinates for d6k61l_:

Click to download the PDB-style file with coordinates for d6k61l_.
(The format of our PDB-style files is described here.)

Timeline for d6k61l_: