SCOPe 2.07: Domain d6k61m

Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.19: Subunit XII of photosystem I reaction centre, PsaM [81548] (1 family)
automatically mapped to Pfam PF07465
Family f.23.19.1: Subunit XII of photosystem I reaction centre, PsaM [81547] (2 proteins)
Protein automated matches [375510] (1 species)
not a true protein
Species Nostoc sp. [TaxId:103690] [375511] (1 PDB entry)

Domain d6k61m_: 6k61 M: [375512]
Other proteins in same PDB: d6k61a_, d6k61b_, d6k61c_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61l_
automated match to d1jb0m_
complexed with bcr, cl0, cla, lhg, lmg, pqn, sf4, sqd

PDB Entry: 6k61 (more details), 2.37 Å

PDB Description: cryo-em structure of the tetrameric photosystem i from a heterocyst- forming cyanobacterium anabaena sp. pcc7120

PDB Compounds: (M:) Photosystem I reaction center subunit XII

SCOPe Domain Sequences for d6k61m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k61m_ f.23.19.1 (M:) automated matches {Nostoc sp. [TaxId: 103690]}
ssisdtqvyialvvalipgllawrlatelyk

SCOPe Domain Coordinates for d6k61m_:

Click to download the PDB-style file with coordinates for d6k61m_.
(The format of our PDB-style files is described here.)

Timeline for d6k61m_:

Thumbnails for d6k61m_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6k61a_, d6k61b_, d6k61c_, d6k61d_, d6k61e_, d6k61f_, d6k61j_, d6k61l_