SCOP 1.65: Domain d1pkp_1: 1pkp 78-148

Lineage for d1pkp_1 (1pkp 78-148)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [54216] (1 PDB entry)

8. Domain d1pkp_1: 1pkp 78-148 [37551]
   Other proteins in same PDB: d1pkp_2

Details for d1pkp_1

PDB Entry: 1pkp, 2.8 Å

PDB Description: the structure of ribosomal protein s5 reveals sites of interaction with 16s rrna

SCOP Domain Sequences for d1pkp_1:

Sequence; same for both SEQRES and ATOM records:

>d1pkp_1 d.14.1.1 (78-148) Ribosomal protein S5, C-terminal domain {Bacillus stearothermophilus}
gttiphevighfgageiilkpasegtgviaggparavlelagisdilsksigsntpinmv
ratfdglkqlk

Timeline for d1pkp_1:

• d1pkp_1 first appeared (with stable ids) in SCOP 1.55
  
• d1pkp_1 appears in SCOP 1.63
  
• d1pkp_1 appears in SCOP 1.67
  
• d1pkp_1 appears in the current release, SCOPe 2.08, called d1pkpa1