SCOPe 2.08: Domain d6jloh_: 6jlo h:

Lineage for d6jloh_ (6jlo h:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (20 PDB entries)

8. Domain d6jloh_: 6jlo h: [375491]
   Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_, d6jloz_
   automated match to d5v2ch_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jloh_

PDB Entry: 6jlo, 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset2)

PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d6jloh_:

Sequence; same for both SEQRES and ATOM records:

>d6jloh_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

Timeline for d6jloh_:

• d6jloh_ first appeared in SCOPe 2.07