Lineage for d6jlni_ (6jln I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632032Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2632033Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2632034Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2632048Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 2632065Domain d6jlni_: 6jln I: [375490]
    Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_
    automated match to d2axti1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlni_

PDB Entry: 6jln (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d6jlni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jlni_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d6jlni_:

Click to download the PDB-style file with coordinates for d6jlni_.
(The format of our PDB-style files is described here.)

Timeline for d6jlni_: