SCOPe 2.08: Domain d6jlnv_: 6jln V:

Lineage for d6jlnv_ (6jln V:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c550 [100991] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries)

8. Domain d6jlnv_: 6jln V: [375461]
   Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnx_, d6jlnz_
   automated match to d3a0hv_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlnv_

PDB Entry: 6jln, 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)

PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d6jlnv_:

Sequence; same for both SEQRES and ATOM records:

>d6jlnv_ a.3.1.1 (V:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

Timeline for d6jlnv_:

• d6jlnv_ first appeared in SCOPe 2.07