Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Cytochrome c550 [100991] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (18 PDB entries) |
Domain d6jlnv_: 6jln V: [375461] Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnx_, d6jlnz_ automated match to d3a0hv_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jln (more details), 2.4 Å
SCOPe Domain Sequences for d6jlnv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlnv_ a.3.1.1 (V:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d6jlnv_: