SCOPe 2.07: Domain d1hxqb2: 1hxq B:178-347

Lineage for d1hxqb2 (1hxq B:178-347)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)

7. Species Escherichia coli [TaxId:562] [54209] (4 PDB entries)

8. Domain d1hxqb2: 1hxq B:178-347 [37545]
   complexed with fe, u5p, zn

Details for d1hxqb2

PDB Entry: 1hxq, 1.86 Å

PDB Description: the structure of nucleotidylated galactose-1-phosphate uridylyltransferase from escherichia coli at 1.86 angstroms resolution

PDB Compounds: (B:) hexose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d1hxqb2:

Sequence; same for both SEQRES and ATOM records:

>d1hxqb2 d.13.1.2 (B:178-347) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]}
eaeredrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllp
kahvlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlha
hfyppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresg

Timeline for d1hxqb2:

• d1hxqb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hxqb2 appears in SCOPe 2.06
  
• d1hxqb2 appears in the current release, SCOPe 2.08