SCOPe 2.08: Domain d6jlnm_: 6jln M:

Lineage for d6jlnm_ (6jln M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)

8. Domain d6jlnm_: 6jln M: [375446]
   Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlno_, d6jlnt_, d6jlnu_, d6jlnv_, d6jlnx_, d6jlnz_
   automated match to d2axtm1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jlnm_

PDB Entry: 6jln, 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset2)

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d6jlnm_:

Sequence; same for both SEQRES and ATOM records:

>d6jlnm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

Timeline for d6jlnm_:

• d6jlnm_ first appeared in SCOPe 2.07