SCOPe 2.08: Domain d6jh0d2: 6jh0 D:85-161

Lineage for d6jh0d2 (6jh0 D:85-161)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Canis lupus [TaxId:9615] [375418] (1 PDB entry)

8. Domain d6jh0d2: 6jh0 D:85-161 [375445]
   Other proteins in same PDB: d6jh0a_, d6jh0c_
   automated match to d5chvc2

Details for d6jh0d2

PDB Entry: 6jh0, 2.4 Å

PDB Description: crystal structure of cisg15/ns1b complex

PDB Compounds: (D:) ISG15 ubiquitin-like modifier

SCOPe Domain Sequences for d6jh0d2:

Sequence; same for both SEQRES and ATOM records:

>d6jh0d2 d.15.1.0 (D:85-161) automated matches {Canis lupus [TaxId: 9615]}
ndplsilvrnnkgrsiayevwltqtvaelkqqvcqqehvqadlfwltfegkpmedkhqlg
eygltpqctvfmnlrlr

Timeline for d6jh0d2:

• d6jh0d2 first appeared in SCOPe 2.07