![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
![]() | Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (3 species) |
![]() | Species Influenza b virus (strain b/lee/1940) [TaxId:518987] [375439] (2 PDB entries) |
![]() | Domain d6jh0c_: 6jh0 C: [375440] Other proteins in same PDB: d6jh0b1, d6jh0b2, d6jh0d1, d6jh0d2 automated match to d1xeqa1 |
PDB Entry: 6jh0 (more details), 2.4 Å
SCOPe Domain Sequences for d6jh0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jh0c_ a.16.1.1 (C:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza b virus (strain b/lee/1940) [TaxId: 518987]} qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe nkrmsleerkaigvkmmkvllfmdpsagiegfep
Timeline for d6jh0c_: