Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries) |
Domain d6jlnu_: 6jln U: [375428] Other proteins in same PDB: d6jlna_, d6jlnb_, d6jlnc_, d6jlnd_, d6jlne_, d6jlnf_, d6jlnh_, d6jlni_, d6jlnj_, d6jlnk_, d6jlnl_, d6jlnm_, d6jlno_, d6jlnt_, d6jlnv_, d6jlnx_, d6jlnz_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 6jln (more details), 2.4 Å
SCOPe Domain Sequences for d6jlnu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jlnu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]} elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d6jlnu_: