SCOPe 2.08: Domain d6jlkc_: 6jlk C:

Lineage for d6jlkc_ (6jlk C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)

8. Domain d6jlkc_: 6jlk C: [375422]
   Other proteins in same PDB: d6jlka_, d6jlkd_, d6jlke_, d6jlkf_, d6jlkh_, d6jlki_, d6jlkj_, d6jlkk_, d6jlkl_, d6jlkm_, d6jlko_, d6jlkt_, d6jlku_, d6jlkv_, d6jlkx_, d6jlkz_
   automated match to d5b66c_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jlkc_

PDB Entry: 6jlk, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (1f state, dataset1)

PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d6jlkc_:

Sequence; same for both SEQRES and ATOM records:

>d6jlkc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
whagraraaaagfekgidresepvlsmpsld

Timeline for d6jlkc_:

• d6jlkc_ first appeared in SCOPe 2.07