Lineage for d6jh0b2 (6jh0 B:85-161)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540271Species Canis lupus [TaxId:9615] [375418] (1 PDB entry)
  8. 2540273Domain d6jh0b2: 6jh0 B:85-161 [375420]
    Other proteins in same PDB: d6jh0a_, d6jh0c_
    automated match to d5chvc2

Details for d6jh0b2

PDB Entry: 6jh0 (more details), 2.4 Å

PDB Description: crystal structure of cisg15/ns1b complex
PDB Compounds: (B:) ISG15 ubiquitin-like modifier

SCOPe Domain Sequences for d6jh0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jh0b2 d.15.1.0 (B:85-161) automated matches {Canis lupus [TaxId: 9615]}
ndplsilvrnnkgrsiayevwltqtvaelkqqvcqqehvqadlfwltfegkpmedkhqlg
eygltpqctvfmnlrlr

SCOPe Domain Coordinates for d6jh0b2:

Click to download the PDB-style file with coordinates for d6jh0b2.
(The format of our PDB-style files is described here.)

Timeline for d6jh0b2: