![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Canis lupus [TaxId:9615] [375418] (1 PDB entry) |
![]() | Domain d6jh0b1: 6jh0 B:9-84 [375419] Other proteins in same PDB: d6jh0a_, d6jh0c_ automated match to d5chwa1 |
PDB Entry: 6jh0 (more details), 2.4 Å
SCOPe Domain Sequences for d6jh0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jh0b1 d.15.1.0 (B:9-84) automated matches {Canis lupus [TaxId: 9615]} gnltvkmlggeeflvplrdsmlaselkqqialktgvpafqqrlathpagtvlqdgislir qglcpgstvllvvkns
Timeline for d6jh0b1:
![]() Domains from other chains: (mouse over for more information) d6jh0a_, d6jh0c_, d6jh0d1, d6jh0d2 |