Lineage for d1gupd2 (1gup D:178-345)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30255Fold d.13: HIT-like [54196] (1 superfamily)
  4. 30256Superfamily d.13.1: HIT-like [54197] (2 families) (S)
  5. 30293Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
  6. 30294Protein Galactose-1-phosphate uridylyltransferase [54208] (1 species)
  7. 30295Species Escherichia coli [TaxId:562] [54209] (4 PDB entries)
  8. 30315Domain d1gupd2: 1gup D:178-345 [37541]

Details for d1gupd2

PDB Entry: 1gup (more details), 1.8 Å

PDB Description: structure of nucleotidyltransferase complexed with udp-galactose

SCOP Domain Sequences for d1gupd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gupd2 d.13.1.2 (D:178-345) Galactose-1-phosphate uridylyltransferase {Escherichia coli}
eaeredrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllp
kahvlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlha
hfyppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfre

SCOP Domain Coordinates for d1gupd2:

Click to download the PDB-style file with coordinates for d1gupd2.
(The format of our PDB-style files is described here.)

Timeline for d1gupd2: