Lineage for d6ihza3 (6ihz A:219-530)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (10 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (139 PDB entries)
  8. 3075321Domain d6ihza3: 6ihz A:219-530 [375383]
    Other proteins in same PDB: d6ihza1, d6ihza2, d6ihzb1, d6ihzb2
    automated match to d2b3oa3
    mutant

Details for d6ihza3

PDB Entry: 6ihz (more details), 2.6 Å

PDB Description: the atomic structure of shp2 e76a mutant
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6ihza3:

Sequence, based on SEQRES records: (download)

>d6ihza3 c.45.1.0 (A:219-530) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr
yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv
ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl
relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh
csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav
qhyietlqrrie

Sequence, based on observed residues (ATOM records): (download)

>d6ihza3 c.45.1.0 (A:219-530) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trinaaeiesrvrelskqgfweefetlqqqeckllysrkegqrqenknknryknilpfdh
trvvlhdgdppvsdyinaniimpekksyiatqgclqntvndfwrmvfqensrvivmttke
vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
rekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrie

SCOPe Domain Coordinates for d6ihza3:

Click to download the PDB-style file with coordinates for d6ihza3.
(The format of our PDB-style files is described here.)

Timeline for d6ihza3:

  • d6ihza3 is new in SCOPe 2.07-stable