Lineage for d6izwc_ (6izw C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971141Family d.110.7.0: automated matches [375374] (1 protein)
    not a true family
  6. 2971142Protein automated matches [375375] (2 species)
    not a true protein
  7. 2971143Species Myxococcus xanthus [TaxId:246197] [375376] (1 PDB entry)
  8. 2971144Domain d6izwc_: 6izw C: [375377]
    automated match to d1j3wb_
    complexed with gsp, mg, so4

Details for d6izwc_

PDB Entry: 6izw (more details), 2.4 Å

PDB Description: myxococcus xanthus mgla bound to gtp-gamma-s and mglb
PDB Compounds: (C:) Gliding motility protein MglB

SCOPe Domain Sequences for d6izwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6izwc_ d.110.7.0 (C:) automated matches {Myxococcus xanthus [TaxId: 246197]}
vmyeeeftkinavcdrltkdanakvvflvdkngqlissagqtqnidttslasltagnvaa
mgglakligenefpnqfhegakdslymtivgsrvvlvvifdnrtslglvrlrikkasdel
tkife

SCOPe Domain Coordinates for d6izwc_:

Click to download the PDB-style file with coordinates for d6izwc_.
(The format of our PDB-style files is described here.)

Timeline for d6izwc_: