SCOPe 2.08: Domain d6guxa_: 6gux A:

Lineage for d6guxa_ (6gux A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein automated matches [190122] (8 species)
   not a true protein

7. Species Halorubrum sodomense [TaxId:35743] [375306] (5 PDB entries)

8. Domain d6guxa_: 6gux A: [375342]
   automated match to d2z55a_
   complexed with ca, cl, d12, dd9, na, r16, ret

Details for d6guxa_

PDB Entry: 6gux, 1.3 Å

PDB Description: dark-adapted structure of archaerhodopsin-3 at 100k

PDB Compounds: (A:) Archaerhodopsin-3

SCOPe Domain Sequences for d6guxa_:

Sequence; same for both SEQRES and ATOM records:

>d6guxa_ f.13.1.1 (A:) automated matches {Halorubrum sodomense [TaxId: 35743]}
eagydllgdgrpetlwlgigtllmligtfyflvrgwgvtdkdareyyavtilvpgiasaa
ylsmffgigltevtvggemldiyyaryadwlfttplllldlallakvdrvtigtlvgvda
lmivtgligalshtaiaryswwlfsticmivvlyflatslrsaakergpevastfntlta
lvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdteap
e

Timeline for d6guxa_:

• d6guxa_ first appeared in SCOPe 2.07