Lineage for d6hn1a3 (6hn1 A:388-583)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337048Species Goat (Capra hircus) [TaxId:9925] [341296] (4 PDB entries)
  8. 3075274Domain d6hn1a3: 6hn1 A:388-583 [375336]
    automated match to d1n5ua3
    complexed with cl, dif

Details for d6hn1a3

PDB Entry: 6hn1 (more details), 1.55 Å

PDB Description: complex of caprine serum albumin with diclofenac
PDB Compounds: (A:) Albumin

SCOPe Domain Sequences for d6hn1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hn1a3 a.126.1.0 (A:388-583) automated matches {Goat (Capra hircus) [TaxId: 9925]}
kkncelfekhgeygfqnalivrytrkapqvstptlveisrslgkvgtkccakpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsdltldetyvpkpfdgesft
fhadictlpdtekqikkqtalvellkhkpkatdeqlktvmenfvafvdkccaaddkegcf
llegpklvastqaala

SCOPe Domain Coordinates for d6hn1a3:

Click to download the PDB-style file with coordinates for d6hn1a3.
(The format of our PDB-style files is described here.)

Timeline for d6hn1a3:

  • d6hn1a3 is new in SCOPe 2.07-stable