Lineage for d6hn1a2 (6hn1 A:196-387)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. Protein automated matches [254493] (6 species)
    not a true protein
  7. Species Goat (Capra hircus) [TaxId:9925] [341296] (4 PDB entries)
  8. Domain d6hn1a2: 6hn1 A:196-387 [375335]
    automated match to d3uiva1
    complexed with cl, dif

Details for d6hn1a2

PDB Entry: 6hn1 (more details), 1.55 Å

PDB Description: complex of caprine serum albumin with diclofenac
PDB Compounds: (A:) Albumin

SCOPe Domain Sequences for d6hn1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hn1a2 a.126.1.0 (A:196-387) automated matches {Goat (Capra hircus) [TaxId: 9925]}
rlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhkecchgdllecadd
radlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpenlppltadfaedkevc
knyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccakedphacyatvfdk
lkhlvdepqnli

SCOPe Domain Coordinates for d6hn1a2 are not available.

Timeline for d6hn1a2:

Domains from same chain:
(mouse over for more information)
d6hn1a1, d6hn1a3