Lineage for d6hjxh1 (6hjx H:6-123)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Llama (Lama glama) [TaxId:9844] [187485] (227 PDB entries)
  8. Domain d6hjxh1: 6hjx H:6-123 [375322]
    Other proteins in same PDB: d6hjxf2, d6hjxg2, d6hjxh2, d6hjxi2, d6hjxj2
    automated match to d5da4a_
    complexed with lmt, mes, na, p6g, pty; mutant

Details for d6hjxh1

PDB Entry: 6hjx (more details), 2.5 Å

PDB Description: x-ray structure of a pentameric ligand gated ion channel from erwinia chrysanthemi (elic) 7'c pore mutant (l238c) in complex with nanobody 72
PDB Compounds: (H:) nanobody 72

SCOPe Domain Sequences for d6hjxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hjxh1 b.1.1.1 (H:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrifstnvmgwfrqapgkerefvatvgriggstvyadfvk
grftlsrdnaknmvylqmnslkpedtavyycgariggsdrlapenygywgqgtqvtvs

SCOPe Domain Coordinates for d6hjxh1 are not available.

Timeline for d6hjxh1:

Domains from same chain:
(mouse over for more information)
d6hjxh2
Domains from other chains:
(mouse over for more information)
d6hjxf1, d6hjxf2, d6hjxg1, d6hjxg2, d6hjxi1, d6hjxi2, d6hjxj1, d6hjxj2