Lineage for d6guza_ (6guz A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. Protein automated matches [190122] (8 species)
    not a true protein
  7. Species Halorubrum sodomense [TaxId:35743] [375306] (5 PDB entries)
  8. Domain d6guza_: 6guz A: [375321]
    automated match to d2z55a_
    complexed with ca, cl, d10, dd9, na, r16, ret

Details for d6guza_

PDB Entry: 6guz (more details), 1.9 Å

PDB Description: ground state structure of archaerhodopsin-3 obtained from lcp crystals using a thin-film sandwich at room temperature
PDB Compounds: (A:) Archaerhodopsin-3

SCOPe Domain Sequences for d6guza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6guza_ f.13.1.1 (A:) automated matches {Halorubrum sodomense [TaxId: 35743]}
eagydllgdgrpetlwlgigtllmligtfyflvrgwgvtdkdareyyavtilvpgiasaa
ylsmffgigltevtvggemldiyyaryadwlfttplllldlallakvdrvtigtlvgvda
lmivtgligalshtaiaryswwlfsticmivvlyflatslrsaakergpevastfntlta
lvlvlwtaypilwiigtegagvvglgietllfmvldvtakvgfgfillrsrailgdteap

SCOPe Domain Coordinates for d6guza_ are not available.

Timeline for d6guza_: