SCOPe 2.07: Domain d6gw3d2: 6gw3 D:230-383

Lineage for d6gw3d2 (6gw3 D:230-383)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Cannabis sativa [TaxId:3483] [375308] (1 PDB entry)

8. Domain d6gw3d2: 6gw3 D:230-383 [375317]
   automated match to d3ov2a2
   complexed with coa, peg

Details for d6gw3d2

PDB Entry: 6gw3, 1.39 Å

PDB Description: structure of tks from cannabis sativa in complex with coa

PDB Compounds: (D:) 3,5,7-trioxododecanoyl-CoA synthase,3,5,7-trioxododecanoyl-CoA synthase

SCOPe Domain Sequences for d6gw3d2:

Sequence; same for both SEQRES and ATOM records:

>d6gw3d2 c.95.1.0 (D:230-383) automated matches {Cannabis sativa [TaxId: 3483]}
ifelvstgqtilpnsegtigghireaglifdlhkdvpmlisnniekclieaftpigisdw
nsifwithpggkaildkveeklhlksdkfvdsrhvlsehgnmssstvlfvmdelrkrsle
egksttgdgfewgvlfgfgpgltvervvvrsvpi

Timeline for d6gw3d2:

• d6gw3d2 is new in SCOPe 2.07-stable
  
• d6gw3d2 appears in the current release, SCOPe 2.08