Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Cannabis sativa [TaxId:3483] [375308] (1 PDB entry) |
Domain d6gw3d2: 6gw3 D:230-383 [375317] automated match to d3ov2a2 complexed with coa, peg |
PDB Entry: 6gw3 (more details), 1.39 Å
SCOPe Domain Sequences for d6gw3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gw3d2 c.95.1.0 (D:230-383) automated matches {Cannabis sativa [TaxId: 3483]} ifelvstgqtilpnsegtigghireaglifdlhkdvpmlisnniekclieaftpigisdw nsifwithpggkaildkveeklhlksdkfvdsrhvlsehgnmssstvlfvmdelrkrsle egksttgdgfewgvlfgfgpgltvervvvrsvpi
Timeline for d6gw3d2: