Lineage for d6gw3b2 (6gw3 B:230-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917518Species Cannabis sativa [TaxId:3483] [375308] (1 PDB entry)
  8. 2917522Domain d6gw3b2: 6gw3 B:230-385 [375315]
    automated match to d3ov2a2
    complexed with coa, peg

Details for d6gw3b2

PDB Entry: 6gw3 (more details), 1.39 Å

PDB Description: structure of tks from cannabis sativa in complex with coa
PDB Compounds: (B:) 3,5,7-trioxododecanoyl-CoA synthase

SCOPe Domain Sequences for d6gw3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gw3b2 c.95.1.0 (B:230-385) automated matches {Cannabis sativa [TaxId: 3483]}
ifelvstgqtilpnsegtigghireaglifdlhkdvpmlisnniekclieaftpigisdw
nsifwithpggkaildkveeklhlksdkfvdsrhvlsehgnmssstvlfvmdelrkrsle
egksttgdgfewgvlfgfgpgltvervvvrsvpiky

SCOPe Domain Coordinates for d6gw3b2:

Click to download the PDB-style file with coordinates for d6gw3b2.
(The format of our PDB-style files is described here.)

Timeline for d6gw3b2: