SCOPe 2.07: Domain d6gw3b1: 6gw3 B:3-229

Lineage for d6gw3b1 (6gw3 B:3-229)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Cannabis sativa [TaxId:3483] [375308] (1 PDB entry)

8. Domain d6gw3b1: 6gw3 B:3-229 [375314]
   automated match to d3ov2a1
   complexed with coa, peg

Details for d6gw3b1

PDB Entry: 6gw3, 1.39 Å

PDB Description: structure of tks from cannabis sativa in complex with coa

PDB Compounds: (B:) 3,5,7-trioxododecanoyl-CoA synthase

SCOPe Domain Sequences for d6gw3b1:

Sequence; same for both SEQRES and ATOM records:

>d6gw3b1 c.95.1.0 (B:3-229) automated matches {Cannabis sativa [TaxId: 3483]}
hlraegpasvlaigtanpenillqdefpdyyfrvtksehmtqlkekfrkicdksmirkrn
cflneehlkqnprlvehemqtldarqdmlvvevpklgkdacakaikewgqpkskithlif
tsasttdmpgadyhcakllglspsvkrvmmyqlgcygggtvlriakdiaennkgarvlav
ccdimaclfrgpsesdlellvgqaifgdgaaavivgaepdesvgerp

Timeline for d6gw3b1:

• d6gw3b1 is new in SCOPe 2.07-stable
  
• d6gw3b1 appears in the current release, SCOPe 2.08