Lineage for d6gw3c2 (6gw3 C:230-385)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. Protein automated matches [196909] (82 species)
    not a true protein
  7. Species Cannabis sativa [TaxId:3483] [375308] (1 PDB entry)
  8. Domain d6gw3c2: 6gw3 C:230-385 [375312]
    automated match to d3ov2a2
    complexed with coa, peg

Details for d6gw3c2

PDB Entry: 6gw3 (more details), 1.3900000000000001 Å

PDB Description: structure of tks from cannabis sativa in complex with coa
PDB Compounds: (C:) 3,5,7-trioxododecanoyl-CoA synthase

SCOPe Domain Sequences for d6gw3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gw3c2 c.95.1.0 (C:230-385) automated matches {Cannabis sativa [TaxId: 3483]}
ifelvstgqtilpnsegtigghireaglifdlhkdvpmlisnniekclieaftpigisdw
nsifwithpggkaildkveeklhlksdkfvdsrhvlsehgnmssstvlfvmdelrkrsle
egksttgdgfewgvlfgfgpgltvervvvrsvpiky

SCOPe Domain Coordinates for d6gw3c2 are not available.

Timeline for d6gw3c2:

Domains from same chain:
(mouse over for more information)
d6gw3c1
Domains from other chains:
(mouse over for more information)
d6gw3a1, d6gw3a2, d6gw3b1, d6gw3b2, d6gw3d1, d6gw3d2